DPCstruct | MC10705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 374 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 14.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.91 |
| Pfam Score | 97.59 |
| Assigned Pfam label(s) | PF05856- CL0046- PF16607- CL0010- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K3MG28 | 6-101 | NQTNEFNVGQRVHASGDSTRIGTVKYVGNVEGYSDTWVGIDWDYGGGKHDGSINNVRYFHAKSEKSGSFVRPKNLCKGISLLQALEK… |
| A0A402GAI7 | 1-49 | VGTLRFCGTTEFASGQWVGVELDEPDGKNDGSVGGIRYFICPPKHGRSR |
| A0A6A4KH40 | 108-214 | None |
| A0A0A0LXY6 | 130-216 | None |
| A0A0S4JTN6 | 1-96 | None |
| A0A4Y7LZL2 | 227-320 | None |
| A0A080ZX82 | 3-94 | None |
| A0A384DTM7 | 105-187 | None |
| J6F411 | 11-113 | None |
| A0A7R8X8J2 | 63-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.