DPCstruct | MC10702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 213 ± 23 aa |
| Standard deviation of domain lengths | 23.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7P400 | 184-356 | EEYVFNKKYIPYQVLGIDSGHVKDLMFVSKDGIFFYNFETKEEERVGDNIFKGKITNILSSVISDDKNIYYLQSYNIYKKKRTKHGY… |
| R5WY71 | 1-199 | MTFVNNEGIYYYDNQKKKQKRAGDNIFTGNVEELSPNVFTDDKNIYYFHAYDVWKRYKNAGDVLFSQNTEICYLDKKDGWEKVKDIR… |
| A0A380CW98 | 277-475 | None |
| A0A4V3DEB6 | 270-480 | None |
| G6C337 | 111-331 | None |
| A0A133P8K6 | 33-262 | None |
| E0E3X5 | 274-497 | None |
| A0A0B7HNK4 | 16-241 | None |
| Q8RE35 | 150-393 | None |
| A0A241WMS6 | 301-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.