DPCstruct | MC1070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 36 ± 3 aa |
| Standard deviation of domain lengths | 2.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 80.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0VV52 | 15-48 | ICRKCYARLHPRAVNCRKKKCGHSNQLRPKKKIK |
| C1LTZ5 | 1-35 | MICRKCYARLHPKATNCRKRKCGHTSNVRPKKKLR |
| A0A5M3Z2I0 | 317-350 | None |
| A0A812KSG5 | 1-34 | None |
| A0A812ZYN2 | 1-39 | None |
| A0A4S4MYC1 | 408-441 | None |
| A0A452YXP2 | 1-40 | None |
| A0A0C9ML83 | 1-40 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.