DPCstruct | MC10698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 16.39 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.57 |
| Pfam Score | 77.09 |
| Assigned Pfam label(s) | CL0123- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A117SS01 | 79-154 | GKPEGVRLSKSYPGRVIITAVAELKSVLSFLASNKISVNDTLTVIRRRRGDVTVDFNGRQIVIDESIASGIVVIGT |
| A0A3M1HMP4 | 98-176 | QPRTSTSGSLVTLPPGRTARVVALAPSLPPARQAYLQACGLVPGCQIRIVQQSPVTVVRFDHTELALERELAEAVQVES |
| A0A415ZRE6 | 28-125 | None |
| A0A831RJY1 | 76-151 | None |
| A0A3R6G711 | 1-89 | None |
| A0A842X9R1 | 57-136 | None |
| A0A3A0GA22 | 240-327 | None |
| A0A3B9P828 | 220-333 | None |
| A0A7K3WP13 | 2-70 | None |
| A0A087C4J9 | 87-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.