DPCstruct | MC10697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 133 ± 24 aa |
| Standard deviation of domain lengths | 24.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1G1F9 | 17-141 | EEKRMVKELADRDAEVRRHEQAHLRTAGPYALGGPHYTYQVGPDGKRYAVGGEVQVDMSEVEGDPEATLRKAIRIQQAAMAPADPSA… |
| A0A0U9IAU9 | 14-134 | NTIEQQKINQIIQKLRNIENRVIAHELAHKSVAGRYAKSVSYTYTKGPDGRMYVTGGEVSLDVSEKRSPEETIKKMEIIEAAALAPS… |
| A0A7X8CZE3 | 1-94 | None |
| A0A1X7IYN1 | 152-269 | None |
| A0A1G3YLW2 | 37-163 | None |
| A0A7W7NHE9 | 4-154 | None |
| A0A2E6QG17 | 135-243 | None |
| A0A7C3D8C2 | 70-212 | None |
| A0A1I3DDC1 | 170-311 | None |
| A0A7H9CHC1 | 59-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.