DPCstruct | MC10696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1STB1 | 90-176 | DAKLRKAVINSVVTKLLFSDITQGDALIQLRIQVLGFNQEKYAKLVNVSRKKISDIENNRSNPSVEVLNKVFKPFGLNVGLIPISPT |
| A0A6H9S4D7 | 15-96 | EEVRSIVLSVQERIRLGRITLGDAVRLLRNDVLKMNQDDFAKQCKISRRTLSQFELGCGNPTMHTVNSVLEQFGLTLCIGRR |
| A0A656HC11 | 3-94 | None |
| A0A7Z3BN44 | 1-105 | None |
| A0A3A6T706 | 19-117 | None |
| A0A0F9VWE5 | 1-86 | None |
| A0A2N8RX25 | 1-86 | None |
| A0A432Z9A6 | 38-130 | None |
| A0A085G0M2 | 2-85 | None |
| A0A250IY65 | 10-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.