DPCstruct | MC10695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 240 ± 21 aa |
| Standard deviation of domain lengths | 21.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8CE26 | 47-287 | ITHLYGGELNPPFETVLDTTKSGKYYLTKADRDLLARIYEFAQEQGAAPRYVTSLARELADYRQFKNGALLGSLNSGDIYDIEGHQL… |
| A0A2L1J8G9 | 3-250 | ARLFGGSEPPVAKPSATRDNSHLNPADFLNLDDRNLIADMYAYAHAEGADLTYVTYLASILSTYRYYNDGRQLGGGNNGYDADGYRV… |
| A0A077LHZ7 | 139-413 | None |
| A0A6B9D1K7 | 520-756 | None |
| A0A3R8U2H2 | 73-327 | None |
| A0A379JN76 | 292-528 | None |
| A0A6M3ZLI3 | 321-582 | None |
| A0A7D4DV79 | 47-298 | None |
| A0A3R9ANH7 | 23-262 | None |
| B9B9V6 | 1-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.