DPCstruct | MC10691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 321 ± 37 aa |
| Standard deviation of domain lengths | 37.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 65.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 43.02 |
| Pfam Score | 86.61 |
| Assigned Pfam label(s) | PF15628- PF15629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L2NFB9 | 1-296 | MYVTPPSSHFDQEVNNSGSTYYSQTCEPIIEVPPSPEPEAKETLPIIGDIEDLFSEPDEEEIPIIRLNTAEFKETLKETMDSDNIYL… |
| Q9SJQ6 | 1032-1392 | TFGKVFCTKSKPNCNACPMKGECRHFASAFASARLALPSTEKGMGTPDKNPLPLHLPEPFQREQGSEVVQHSEPAKKVTCCEPIIEE… |
| A0A1D6QN83 | 1531-1892 | None |
| A0A835U6Y5 | 291-665 | None |
| B8A274 | 128-501 | None |
| A0A2G2WUX1 | 337-634 | None |
| A0A151TV26 | 673-1011 | None |
| A0A3L6RV73 | 1-266 | None |
| A0A1S4BZ82 | 1-333 | None |
| A0A067DR76 | 797-1103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.