DPCstruct | MC10690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 7.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 59.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061G9X8 | 1-87 | MNLFNLNKEREEGYFIVDGNFVEYRNDNEIKDVWLDNVEVDTKYIGKTSATTNNEDNNEVGTQDLSFQDIGIMKRRIVDVLKPGETV |
| A0A5N5N8N7 | 86-189 | EVVYEENENFVEDGIQIEPFNLEKEREEGYFDAEGNFVEYINENEIKDAWLDSVQVDERYVGKTSVASINEDDDKDDGRDLSSEEIG… |
| A0A2I0XG71 | 1-101 | None |
| A0A0L9VQW0 | 84-179 | None |
| A0A7N2MX82 | 104-204 | None |
| A0A835IRH6 | 177-277 | None |
| A0A833TBR4 | 113-194 | None |
| A0A5J5WGQ6 | 93-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.