DPCstruct | MC1069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15433 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1LLI8 | 1-84 | MWSFPINNEQDWDSESDVPFYEHVFLENHLNKDHLKCKPLASFLELVCNGLSQNPHYSVNDKKKHLEWFSKFFDDKISQINASV |
| A0A504YU40 | 21-103 | LWRFPIDNEQDWDTENNVPFHEHMFLDQYTDKALRKSPPVAAFLDLVCAGLAQNPHFTVAEKRAHLQWYAEYFKDKLESIDAS |
| A0A6P3VXT4 | 561-648 | None |
| A0A7M7IHA1 | 84-165 | None |
| A0A6I9HGY7 | 207-285 | None |
| A0A2P8XWS6 | 115-198 | None |
| A0A4U5M958 | 65-141 | None |
| A0A654GMT8 | 412-512 | None |
| L9KGW1 | 559-639 | None |
| A0A154PAR5 | 443-529 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.