DPCstruct | MC10688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 123 ± 19 aa |
| Standard deviation of domain lengths | 18.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432WA84 | 34-146 | QPSPWQLLEAEFSQTLSGTMSELENGEVYFNQYSFYAGDGRLCRIYYYGEQDLTEGLVCWHEESGWQYMLAEEGPDSVTQDDAPSLI… |
| A0A1V1PN43 | 103-228 | RSPRFSLTQLNGDIGGALEAVRSGESREVAGGRVTLALTVQTESGAFCRQFRLSTTQETTDALACRDQANWNVVVAAAAPHANNNAY… |
| A0A317FJD8 | 40-162 | None |
| A0A419R0C8 | 30-115 | None |
| A0A7Y6Z734 | 3-112 | None |
| A0A101JWY9 | 123-257 | None |
| A0A530ZPL6 | 5-120 | None |
| J8VP22 | 151-259 | None |
| A0A519HBG2 | 16-136 | None |
| A0A430BFI7 | 9-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.