DPCstruct | MC10687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 112 ± 23 aa |
| Standard deviation of domain lengths | 23.48 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H6SQ82 | 1-69 | MDLETARAQGILCEGQDGLVRVLTGGPEATALAETTNARRLQIYRDSAQRQGVGVEQVQAVSGASLRQK |
| A0A1V1PIU2 | 10-117 | FGAIALAGALAAAPALAQDNAISQGRAAGVIGEQADGYLGVRTGQTASADLRARVDQLNIRRRAEYTTRAERNNVTPNEMAASIVCV… |
| A0A833H4F4 | 55-211 | None |
| S3V118 | 6-166 | None |
| A0A7V6HGN9 | 2-107 | None |
| A0A7X9ARB0 | 46-169 | None |
| A0A7C7ZG46 | 41-146 | None |
| A0A3B1BSS8 | 46-168 | None |
| A0A1Y5GZN1 | 15-86 | None |
| A0A7V3AHA1 | 8-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.