DPCstruct | MC10686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 8.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.31 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0039- PF20979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Y1CS71 | 1-95 | MIVGFERGVPVSVDGKPVSMLAAIEELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHTELEHVTLERELGRFKRQTD… |
| A0A1S6WWB2 | 1-93 | MVLKKGDAVSINGKILSPAILLAQLNQYEYDNGIGRLDLVENHFIGMKSRDIYETSGGIILLTAHRAIESLTLDRGVAHLKDELMPC… |
| A0A7R9KWP3 | 164-276 | None |
| A0A7C5DAG4 | 33-140 | None |
| A0A5J5CR08 | 322-435 | None |
| A0A5N5ICM9 | 280-386 | None |
| A0A667I390 | 395-507 | None |
| A0A377C579 | 75-184 | None |
| A0A2B4S7F2 | 211-323 | None |
| A0A2K5NWD3 | 177-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.