DPCstruct | MC10685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 49 ± 3 aa |
| Standard deviation of domain lengths | 2.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 57.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S6WW89 | 1-54 | MPTYFSKRLIEIAKATRTYTITHGTIGKGNNQVRFALSAYALNPNIKVITPWCD |
| A0A1N0JS14 | 15-64 | IVKHLVAAAREHGGGIVAHGCTGKGNDQVRFEVGFASLAPDLEVLAPVRD |
| A0A0H1RNA7 | 98-146 | None |
| A0A3B3D1F5 | 51-98 | None |
| A0A5N6NWS3 | 175-225 | None |
| A0A4Q4YXY3 | 152-199 | None |
| A0A2I2YYS5 | 82-132 | None |
| A0A812IRJ5 | 345-392 | None |
| A0A812B208 | 591-637 | None |
| A0A2I0RX55 | 98-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.