DPCstruct | MC1068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 92 ± 5 aa |
| Standard deviation of domain lengths | 5.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A384D837 | 483-577 | SHEGDYLESIVFIYSMPGYTCSIRERMLYSSCKSPLLEIVERQLQMDVIRKIEIDNGDELTADFLYEEVHPKQHAHKQSFAKPKGPA… |
| C1LJ43 | 12-95 | FIHTISGYQSSVKSRMLYSSCKAALLTQLEHDYGITFDHRFETDGTDELTSEYLMDILYPKQQEKQLVFQKPQGPMGRRPRTHI |
| H0EJ87 | 114-215 | None |
| G1K3A8 | 242-336 | None |
| V5GLH9 | 116-211 | None |
| A0A0R3TFS0 | 60-149 | None |
| A0A7I2V5B1 | 146-240 | None |
| A0A822CNC2 | 1-86 | None |
| A0A0L0GDP5 | 28-114 | None |
| A0A6G0J4Y3 | 219-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.