DPCstruct | MC10678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 330 ± 59 aa |
| Standard deviation of domain lengths | 58.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8H5C7 | 43-513 | RGHIGAGARVAHVDQVIDVCIGPQARVVGAARLCNGTILSEDAAPATVGSGVVAQDFIFAEGASVEDGAVMHTGFVGQGAHLGKQFS… |
| A0A7S2LN75 | 1-308 | HTGRTADQECWSGEGLFWGLSTVIKFPVDTTHAPYSLIAAGVNLPPQRLLYPFSLIVNNGLDNHIHPGWVLSQSAYTIARNEDKFAT… |
| V5WCM9 | 170-542 | None |
| A0A024FUA6 | 302-648 | None |
| H3H1Y3 | 73-415 | None |
| A0A6N2EA68 | 433-738 | None |
| A0A7S4CFI7 | 122-449 | None |
| A0A7J6S2I6 | 29-355 | None |
| A0A525CAX9 | 1-308 | None |
| A0A7S3QA94 | 415-764 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.