DPCstruct | MC10677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 240 ± 34 aa |
| Standard deviation of domain lengths | 33.56 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2LES0 | 39-286 | RKLFVFVQKLIAGVATAHAEMGLKLYLECALVAENCATMNVRGGNHSSSSCDFNGMAYEFIAQAFILYEDEISDSKIQYRSIVSMVG… |
| A0A7S0KJH3 | 72-326 | TPMEVKSPGLKKSLHFVHKAITALTEIAERHEKALKLYLEAAQLAAVANLESIAYEFFERAFTLYEESITDTKKQVTLLFIIIGTLH… |
| A0A0R3TML1 | 13-249 | None |
| A0A1Q9DZ08 | 351-588 | None |
| B0EH57 | 23-242 | None |
| A0A812NNW3 | 572-800 | None |
| A0A180GGG9 | 158-377 | None |
| M7W5I3 | 490-700 | None |
| A0A7J8CMZ3 | 13-342 | None |
| A0A1E7EP30 | 578-827 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.