DPCstruct | MC10675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 217 ± 23 aa |
| Standard deviation of domain lengths | 23.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2L7H2 | 1-211 | MAQTFGLGYFPVLSTVTYLSSNHSANPTVVFSHTYETAQDHPINSAVISHAERGKHLVFDGRLLHGAPAHPRLRRDVDKSSLTRCYD… |
| F2U0G6 | 146-351 | WYQVRDRDENIGFHFDKDEAVASLEMRLSHPVLSTVTYLSNTGGPTLIFNQSSIDGNDNQPTIPELGALSFPARNKHINFHGNLLHG… |
| A0A7S1FK11 | 2-205 | None |
| A0A813HQJ4 | 207-414 | None |
| A0A812S6W9 | 96-290 | None |
| A0A7S2EW63 | 13-257 | None |
| A0A813F9K7 | 88-282 | None |
| A0A812NTG2 | 144-345 | None |
| A0A812J2Z3 | 309-517 | None |
| A0A7R9UBJ3 | 126-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.