DPCstruct | MC10674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 213 ± 29 aa |
| Standard deviation of domain lengths | 29.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2A9D3 | 159-371 | IVGILAICSVVFSGGTIFLTEESTVALVASVMTICFGPVVVYQKSKLAGLGTLRSQHNALRSKVNEFSTENERMRKNVDRLGGTVSK… |
| A0A7S2KLI8 | 3-215 | VQGVTSLAFLFWLLTLSIATSGVTIFAVICGLVASPLVAYQQRRLTQQENIREVQNEVRHTVNDLQMENMKLQDRNDRLERECRKIN… |
| A0A7S1FU09 | 54-234 | None |
| A0A7S0CCX2 | 20-225 | None |
| A0A7S0GCS4 | 2-191 | None |
| A0A7S2GX79 | 41-252 | None |
| A0A7S1UWZ7 | 5-217 | None |
| A0A7S2M162 | 26-297 | None |
| A0A7S4MV79 | 12-278 | None |
| A0A7S3Q177 | 46-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.