DPCstruct | MC10670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 266 ± 33 aa |
| Standard deviation of domain lengths | 32.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 29.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2K875 | 1-273 | MGSGLRVLQNVHVVNGCAWLNHCSDNRGIFIKTVKENPQIKLWMSGHFHLSHDYEDAISTLGSCTFVQAGVVGEISSRDGRRQTRII… |
| A0A0C2R8L3 | 35-244 | IGCGLRTVPRVHVRSTNAYLDQNHDPYRWYHLFKNSPEIVMWFSAHYHLSHIHPDSHTVRFGTHFFMTGVHGVSFTRDGMRQSRILD… |
| A0A831XDV5 | 200-439 | None |
| A0A7S2EJV0 | 200-510 | None |
| A0A7R9WQ98 | 23-332 | None |
| A8J7Q5 | 1-249 | None |
| A0A812U6W6 | 670-959 | None |
| A0A6L8UVS8 | 161-386 | None |
| A0A7S3YJA2 | 146-445 | None |
| A0A699ZXZ0 | 148-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.