DPCstruct | MC1067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 71 ± 12 aa |
| Standard deviation of domain lengths | 11.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.50 |
| Pfam Score | 98.55 |
| Assigned Pfam label(s) | CL0123- CL0167- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0LYJ0 | 56-121 | SVEEIFYNEVELEEMKYNKTDRTFTYPCPCGDKFVIDLDDLLIGEIKATCPSCSLIIKVSYDMREV |
| C1LGY3 | 3-66 | VFHDEIEIEDMEYDKESETYSYPCPCGDRFLITKEDLLSGDNIARCPSCSLYIRVIYDTENILQ |
| A0A0V0XZJ7 | 628-700 | None |
| A0A2G8L435 | 59-116 | None |
| A0A843U859 | 144-216 | None |
| A0A6S8CTP5 | 2-78 | None |
| A0A4S9IDH7 | 3-73 | None |
| A0A4P9Y181 | 38-96 | None |
| A0A7S1MSF2 | 24-100 | None |
| A0A5J4P1D2 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.