DPCstruct | MC10668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 282 ± 67 aa |
| Standard deviation of domain lengths | 67.44 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5VCG8 | 28-231 | QLDRLRTIFGSSFVVLPRFSAANATELQQALANSETIQNGDALQAVTWFQRAARVREGVARLNASLAYAEALGTGEQINLQVAQLPF… |
| A0A7W0KYJ1 | 2-318 | QALAHGRNALGELLGDPDATVGSIREQLTAIATFGVSAGLVRVAGADAEVAAAGSAAYVGASAIYADVSLRLADAERERTAPAGEPE… |
| A0A6F8XX23 | 474-699 | None |
| A0A847E047 | 15-198 | None |
| A0A7Y5MT06 | 764-1093 | None |
| A0A535DFC2 | 363-609 | None |
| A0A350YXW1 | 977-1201 | None |
| A0A519SJT2 | 22-246 | None |
| A0A7G6RQW5 | 204-576 | None |
| A0A2P8B5E7 | 51-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.