DPCstruct | MC10667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 743 |
|---|---|
| Mean domain length (aa) | 161 ± 35 aa |
| Standard deviation of domain lengths | 34.89 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.02 |
| Pfam Score | 94.06 |
| Assigned Pfam label(s) | CL0125- PF20410- PF01510- CL0187- CL0244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0KVA7 | 32-182 | DPRCTVQVSLRRGDDVLDQVSCLKRHLQGRGLPASRDSRFGVDTVRAVRALGRAEGRPVDGIADSRLLKHLGAWSEPSHTRPPCTVS… |
| A0A8B2UWP1 | 2-97 | TALIYALQRAIGMSSAQANGNYGPGTIAATPTVNQGANSDVVQVIQYGLYVNGFYTGAFDGYFSSDVATAVVAFRKFMNLPPFNSTA… |
| A0A7D4TPM5 | 211-344 | None |
| A0A1E3GYY1 | 175-402 | None |
| C4WK41 | 9-201 | None |
| A0A7T5EWK3 | 214-363 | None |
| A0A7V9DK96 | 490-635 | None |
| A0A3M2HIH5 | 2-216 | None |
| A0A1Z3HTC3 | 117-258 | None |
| A0A6J4LAZ5 | 45-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.