DPCstruct | MC10663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 630 |
|---|---|
| Mean domain length (aa) | 270 ± 72 aa |
| Standard deviation of domain lengths | 71.96 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 88.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.58 |
| Pfam Score | 90.37 |
| Assigned Pfam label(s) | PF14821- CL0063- PF19465- PF08432- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0HCJ7 | 10-288 | RKDESAAPTGSHHLTTAVAQAFYAKVDGGSRLVTGSETGRWGSAVAMAAGLFSLDATVYTGESVSKEERSTIEGWGATVVGSRVTPV… |
| A0A379TAB0 | 3-180 | GEETKSQILDKEGRLPDAVIACVGGGSNAIGMFADFINDASVGLIGVEPGGHGIETGKHGAPLKHGRVGIYFGMKAPMMQTADGQIE… |
| A0A0B8NY27 | 1-162 | None |
| A0A154LJR4 | 20-214 | None |
| A0A171K0M1 | 6-175 | None |
| K8EEU2 | 70-470 | None |
| G4TKY6 | 14-353 | None |
| A0A0C2MNI2 | 15-227 | None |
| A0A378C9T9 | 2-235 | None |
| F4PSW7 | 56-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.