DPCstruct | MC10662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.01 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9T0C5 | 9-88 | ALPNSYLTRDLPVPAVPVRVKLTGPGGDPWVWGDEDAPDCVSGSALDFCLVVTQRRHVEDTVLRATGPVATEWLSIAQAF |
| A0A520X894 | 86-169 | GVTTYSWSFKVRGEEPILPKPYVRLTAPSGAIWEWNEPQDDNKVEGSATEFSQVVTQTRNVGDTGLTLIGEAATTWMNNAQCFA |
| A0A645JGS7 | 37-126 | None |
| C6WCP2 | 164-243 | None |
| A0A538LLR4 | 303-378 | None |
| A0A559VFC8 | 336-419 | None |
| A0A178X3F5 | 2-82 | None |
| A0A812IRQ9 | 252-331 | None |
| A0A8B0DPH0 | 206-292 | None |
| A0A1G9C826 | 10-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.