DPCstruct | MC1066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178MVB0 | 1-87 | MDENGICDWLADATPGATLIYYRGHLGHDRMPSTKVLPEVLRRQVVDVATRIQQAAEAERVFLLQRRNGDDDFSYLAIKAAGHPRSS |
| A0A2D5XJS4 | 2-82 | IREGDFLKWLDHARPGNRLKYHMGHLGVDREPDGALSDALRRELVRIADRAMEFALQGRLHLVQERRGKDVTAYLAVMGSA |
| A0A1G6BI61 | 229-322 | None |
| A0A651FVN5 | 1-92 | None |
| A0A2Z6AIK4 | 1-88 | None |
| A0A6N0Z7S1 | 225-315 | None |
| A0A318GR48 | 5-70 | None |
| A0A7W9EDU1 | 2-70 | None |
| A0A1G6EK24 | 19-112 | None |
| A0A2W5KSS6 | 4-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.