DPCstruct | MC10659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02467 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1L5Y0 | 38-110 | RCADGNGTLTHLFFSDIPLDTARAKAICSKCTLAEDCLAGALDRAEPWGVWGGELVENGRIVANKRPRGRPPK |
| A0A7V9J663 | 3-63 | DLFFSEDLHDIARAKHLCSTCPVRRPCLQGAVERQEPCGVWGGELFLNGRVLAHKRRRGRP |
| A0A4R6JHW9 | 74-145 | None |
| A0A7W1YTY9 | 31-95 | None |
| A0A7K0T6U5 | 2-56 | None |
| A0A4P5RTM4 | 27-102 | None |
| A0A6B1GAG5 | 24-97 | None |
| A0A2M9BHE8 | 92-161 | None |
| A0A6I5VEW7 | 1-77 | None |
| A0A6I5XDS5 | 7-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.