DPCstruct | MC10657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 12.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A022MBC4 | 2-74 | HSEHVQRADSFTCLDCGHGWEGVYDIDVTVDEHARISAAHRLEERRVPSPLESPCCPKCESHKIRIMRPGRVA |
| A0A2B8AM38 | 1-84 | MHEAYSFACMRCGHGWEESYDIAHHRDGSGRPYVVYYAHGRRVPSPLTRPSCTLCGGSVVRIMRSGRVESARGGSLFEQAVPMA |
| A0A5A7S6Z8 | 149-251 | None |
| A0A7W5UXB7 | 1-90 | None |
| A0A1Q9T4P3 | 3-67 | None |
| A0A101Q4W4 | 2-98 | None |
| A0A0M8W4U9 | 1-68 | None |
| A0A7W8ZB52 | 5-97 | None |
| W2F0L5 | 2-89 | None |
| A0A495QGW7 | 33-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.