DPCstruct | MC10654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 282 ± 36 aa |
| Standard deviation of domain lengths | 35.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 19.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0PBY5 | 2-225 | KQALDDKRKEIRKKYAEPYQRFAAQIKDLEMTLDSSINPIDAGLKELEDQQRQLRLKHVQSLIAEMAPNYHVEPGEVEIDPTWLNKT… |
| A0A0R1M5M3 | 1-258 | MKQAVDQVCKAYSGLVVTADSYKQDKKTAAELNKLKKALNDRKIEIKKQATKEVDQFADEVKAMTSELDGVVSQIRAGINAYDEKAK… |
| A0A510WSQ3 | 7-273 | None |
| A0A4Z0XV57 | 1-293 | None |
| A0A4Y9HFB6 | 1-248 | None |
| A0A805ZWY0 | 4-286 | None |
| A0A4Z0R4D7 | 20-338 | None |
| A0A0Z8BJL7 | 13-359 | None |
| A0A3N0AGN1 | 44-363 | None |
| A0A417IHG9 | 96-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.