DPCstruct | MC10653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A243JNA4 | 3-61 | VKEYVVYKSESSLWIGTIQEYAEYMIVLPATVRFYTRPVYQSRIVSRKNARNYITVTEV |
| A0A0P6SCS5 | 3-59 | RKQKQRVYAIYKGDKFIDVGTKREIADQLGITPNSVTFLASPSHKKRSPNDRFAIFI |
| A0A221BX35 | 47-116 | None |
| V6IXI6 | 131-198 | None |
| A0A7U0B7J8 | 1-56 | None |
| A0A5B0BQ09 | 2-62 | None |
| A0A7U5JZ28 | 11-77 | None |
| A0A0A8JLU9 | 7-75 | None |
| A0A2A5RHV0 | 1-66 | None |
| A0A1I4FL07 | 3-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.