DPCstruct | MC10652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 247 ± 21 aa |
| Standard deviation of domain lengths | 20.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7A4V1 | 477-728 | MCESHRLNFKAVLQHFRKVASEEEVEHENSQGYAECVSLLCQEATKLDEWLLHLPPSEQPIYEPNGTRGTAIHFQSHDAALNYAYYI… |
| A0A5N6T843 | 9-234 | IALLRAEEKKLCEWHSQLTPFELPTESFPGLDEAQPSNGHIRPLRFRRHPFAMNYAYYVVARIMQSACFLNGLQQYASDDQTVPIND… |
| A0A0S6XN36 | 118-370 | None |
| A0A395H6G2 | 75-303 | None |
| A0A318YBU6 | 222-489 | None |
| R9UMJ5 | 118-343 | None |
| A0A5N7CPK7 | 594-830 | None |
| A0A4Q4RRR4 | 203-473 | None |
| W3WTE9 | 501-783 | None |
| A0A4S8X217 | 264-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.