DPCstruct | MC10651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 153 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 37.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13868 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5KVL3 | 3-128 | GVIVNASELDRIRKSAIGQTDDDKAVAEKRERALAMHEKSKARAGGWSNTLDGSRKKKEQDRIERIEREERERQKIDMEEARYQLEE… |
| A0A7M5XKW2 | 33-189 | INPNEVAVFQPKDWQRIQNNLARYNEASEKAEQKRRDRENLHAASKELVKHWENTIEGQRLKKLQARKLREEQEEEERKKIDIEEAK… |
| A0A820EWI7 | 49-202 | None |
| H2KQ93 | 59-214 | None |
| A0A7S4KX45 | 19-180 | None |
| A0A6S7IJ52 | 31-189 | None |
| A0A2K6EKJ9 | 40-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.