DPCstruct | MC1065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 144 ± 17 aa |
| Standard deviation of domain lengths | 17.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01627 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7MZJ8 | 6-104 | YHELAEQHVRCVDTPEDRKDFFEEIHRIAHDMKGQGGTFGYPLITSFADSLSNFTSIKTDIDDKMVELVKSHVDAMRAVIKGRVKGE… |
| A0A178MSF4 | 1-116 | MARAEAALANLSGRYIAWAEADLARLEACWALVMAEPDQRPSHLATLFQIAHDMKGQGSTFDYPLVSELGQRLCRLLETRPEALEPM… |
| A0A1C3RFS2 | 84-232 | None |
| A0A1C3RFV1 | 90-235 | None |
| A0A1C3RFZ0 | 90-240 | None |
| A0A516H425 | 19-172 | None |
| A0A2D2AZT2 | 8-156 | None |
| A8TX45 | 91-237 | None |
| A0A1F2Z2Y4 | 5-168 | None |
| A0A1C3RDX2 | 8-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.