DPCstruct | MC10649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812JG90 | 50-128 | KSELEALRAANELREFVTQKEGSALRAWCKHFDPDNDQKISQSQFLRGMSKMGYSGDAAALFKSLDADRSGELSLEEMD |
| C5KKH6 | 16-104 | MKSCKMDMVGTSVMNKFKEQLVLRYGSLSNAWRYSLDVEGDGKIPFTKFCRVARELNFTRSVKQLWRQLDVHQTGFITLSSLDEAAS… |
| A0A7S2NXP9 | 84-192 | None |
| A0A812JHX8 | 353-448 | None |
| A0A812J118 | 370-455 | None |
| A0A813F1M1 | 33-115 | None |
| A0A813GN72 | 12-114 | None |
| A0A7S1RZ69 | 2-106 | None |
| A0A813KUP3 | 38-122 | None |
| A0A813KS72 | 407-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.