DPCstruct | MC10648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 153 ± 19 aa |
| Standard deviation of domain lengths | 18.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.10 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | PF01992- CL0027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5KFR5 | 3-161 | DLVYFNIDDGLGEGLVRGLRSGFLTADDYRRIANGENLEDLRTALEDTDYGTFLQDEPSPLQASTILRKCHERLAEEFDYVRAQSVG… |
| A0A7S1YV70 | 6-167 | MADFNIQHGFPEALVRGMRCSFLGDADYHHMTQCDSLEDVRLNLSESDYAEALVDETSITPTSLQSTAVQKLVTEFQYLRCQSIQPL… |
| A0A7J9IA29 | 1-114 | None |
| A0A4V3WIS0 | 3-166 | None |
| R7QLV0 | 98-261 | None |
| G1T239 | 191-356 | None |
| A0A2Y9P9V5 | 3-162 | None |
| B7P918 | 207-330 | None |
| A0A820ZI45 | 3-178 | None |
| S9W718 | 4-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.