DPCstruct | MC10647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 198 ± 45 aa |
| Standard deviation of domain lengths | 45.12 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.36 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0123- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7PYE7 | 18-206 | IDKVRQLYRDLGVSTILVIGGSGDYFDVADCVICMVEYKPHDLTEQARVIAEKYKAERKPEGGEYFGRITERVPLAHSFDPSKGKRE… |
| A0A416U958 | 4-152 | FPKRTTTDFSNLASGNLIGYLMVPDPEFPRTPSFQRRPQPSKALTGSDRTKVKVMGRESILINKSLTDLRAVEQLTDSEQLNGLAAL… |
| A0A7S2VUD3 | 1-114 | None |
| A0A7S1PD69 | 1-159 | None |
| A0A1E7FER5 | 188-537 | None |
| A0A7C1BKI5 | 19-210 | None |
| C1N3B2 | 474-676 | None |
| W7T242 | 128-340 | None |
| A0A3P3YL31 | 847-1044 | None |
| A0A4S4LTR3 | 484-678 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.