DPCstruct | MC10646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 481 ± 61 aa |
| Standard deviation of domain lengths | 60.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.00 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0361- CL0402 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5KB71 | 71-548 | TLEESLQWLSSDALGGDRVDLPQEVLEKLQAFGDDKVKFPLMFEIYNPTNDTRLHCGVREFSALTGQVLVGPQLAGGLGLMPGEAVR… |
| A0A3B6U1V2 | 2-452 | YFRLSKVRDRVPGASPDQDAEEATCCGVLEFTAREGSAQLPSHVWNNLFQSDIPDVPLIEVRYASLPKGTYAKLKPEGMGFSDLPNH… |
| A0A7J6PD03 | 71-455 | None |
| A0A1V2LN81 | 3-346 | None |
| A0A6G0XUI3 | 19-526 | None |
| A0A803QJP8 | 471-951 | None |
| A0A5J4UX04 | 8-524 | None |
| A0A6A6GLI5 | 247-815 | None |
| A0A443PE19 | 696-1173 | None |
| A0A024UJU7 | 27-526 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.