DPCstruct | MC10645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 146 ± 11 aa |
| Standard deviation of domain lengths | 11.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4UH28 | 8-146 | RPYMLRVSSRTWLRDSHDLFDYETHQHVKVSHFATSCPLKVLRNDSEVSVIDYNNNVDREHDHLLNIVCNRNGDYIVAPAEKIQGSL… |
| C5K9V9 | 1-156 | MSRNPPPPPMHVETTTWTRDSHELFDYESRSTAKSNFQVVGNARFIRRNGEVSMEPDSTDVVEPAEPTDYLLKCVNFDTKYLIQPAE… |
| C5L4G5 | 1-142 | None |
| A0A813JU27 | 162-294 | None |
| A0A1R2CM88 | 3-135 | None |
| A0A7J6U080 | 46-178 | None |
| A0A7J6PMV6 | 7-146 | None |
| A0A812YVI1 | 12-173 | None |
| A0A813FI98 | 1-152 | None |
| A0A2T7IA16 | 4-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.