DPCstruct | MC10642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 84 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18860 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517DQI3 | 95-161 | VRFQLLNGSDEMYLKFICEIFHPTVRFEKGYWKEFLTEINRLLQNDAYELYPSVKISNRDVYGWRIF |
| A0A6P2MTT6 | 1-117 | MDNDDWSHEELLTRCGALTCSQTRFVELLAKLLHPMTRRDVEQTELATAIGAALRRDGFTVRQTGVESGFAIYGVLRAQAGVARAMK… |
| A0A2N2BJD1 | 11-87 | None |
| A0A1F5TS06 | 14-90 | None |
| A0A345HTG0 | 190-278 | None |
| A0A511V0B0 | 77-152 | None |
| A0A442GBH0 | 7-80 | None |
| A0A5C6Y4P6 | 30-122 | None |
| A0A544VRK9 | 4-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.