DPCstruct | MC10641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 7.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318MZJ9 | 1-112 | MAIDVNIRITEDRKKTILTFSPDSGVTGQLELNQLELDNLIQALGSVRWMMAEGQKIAEITGAQIKPAYQTKWAIQKNIEKAETLLA… |
| A0A6P2MG38 | 46-149 | KSTLHVSRPTQNELTLTINGESITLHPEQLGQLIEELAHARASMQPEPPSGIPSGWRFVTTKNPMMAVQKQSNGDRLLVARHTGYGW… |
| A0A7W9U357 | 109-210 | None |
| A0A6M1LYF4 | 1-114 | None |
| C5AKZ6 | 341-446 | None |
| A0A0R3EBA2 | 349-475 | None |
| B0UPL7 | 18-129 | None |
| A0A4Y3QCG9 | 15-131 | None |
| A0A7Z8MEE2 | 96-217 | None |
| B9TI90 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.