DPCstruct | MC10640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 164 ± 19 aa |
| Standard deviation of domain lengths | 19.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4L4M9 | 2-145 | LVGFAPAEDVDLTDEHVRWAICQRALVEPSAHPALRPALVAEPDQSLATSTVLVLFEQLPPGERDSWIAVVPSSGRAFLTRRSAELA… |
| A0A3A4BBM9 | 1-192 | MTSRRDLTRLVAWLVQRAGGDRGGGTVGNSVTAGFEGVLRALASVVGEDVGDLADEHERWRIHRRAIEVPRARELLKEAVSGEPDAA… |
| A0A0Q9CAP5 | 1-171 | None |
| A0A1I6E5H9 | 171-332 | None |
| A0A543I718 | 105-289 | None |
| A0A542JXQ9 | 345-496 | None |
| A0A4R4YHT0 | 1-155 | None |
| A0A7W4UKB9 | 132-314 | None |
| A0A7W9LAR3 | 95-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.