DPCstruct | MC1064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 146 ± 19 aa |
| Standard deviation of domain lengths | 19.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226ETN9 | 229-354 | LAEVRKREFRPNLKAIDALKEMGFKEEDQIVEALRATKNNKDAAVELLTAGKVNTDDLEAGLDQNSHLFSALVSAPTIRLGLSNPKT… |
| A0A2L2YV00 | 3-134 | RCFRAYKRKVFRPSATALSNLKEMGFAEADILDALRINGNNQDTACDWLLSDKKPNFEDVEEGLDPDGPIYKSIMSNPVVQLGLSNP… |
| A0A814P8I6 | 748-881 | None |
| A0A3B0JQ67 | 260-430 | None |
| T1H4U4 | 15-155 | None |
| A0A0N7ZB13 | 290-468 | None |
| A9V2W2 | 237-367 | None |
| G1L9Z7 | 143-304 | None |
| S9YRQ2 | 664-824 | None |
| A0A820ZN25 | 121-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.