DPCstruct | MC10636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 144 ± 24 aa |
| Standard deviation of domain lengths | 23.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09965 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9XQY6 | 2-94 | HYGSDAPAYWSDAVAAQPGSELTSDQCVIQGEHLFVKGVIEIPVVGGDVFSWAAWVSLSPQNFARMSELWETSGREQEPPYFGWLAS… |
| A0A3A4AYX3 | 8-134 | TCACCGRPLYDTDRIDMRFGLPDIALDLPESAREKVNGGLLRVRGHGCFARCLLPVRLSGGLELVLGTWMEIGEEDLEHARAVWDDD… |
| A0A542HA60 | 8-196 | None |
| A0A7Y4ZKY0 | 147-289 | None |
| A0A5B8BV04 | 133-292 | None |
| A0A4R0KH81 | 79-238 | None |
| A0A517QVN9 | 31-191 | None |
| A0A7K2FMV7 | 261-420 | None |
| A0A0Q8PSY3 | 123-288 | None |
| A0A5B8AZC6 | 6-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.