DPCstruct | MC10634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 246 ± 21 aa |
| Standard deviation of domain lengths | 20.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1B8N3 | 33-264 | EQAKELEALRKSIDDAASVGTGLWLSYLFALFYIGIAAGGVSHRDLLLENPVKLPFLGVELPLLAFFFLAPILFIVSHAYTLLHFVI… |
| Q6NBQ9 | 13-262 | LEAALNDSANRVSTIWVSFLVLLLYFAIALGAVTHRQLLIGDALRLPVLNVDLPLVGFFFVSPCLLVAFHLYVLLQVMLLARTAAAF… |
| A0A4R2LR00 | 63-342 | None |
| A0A2E6Q907 | 195-454 | None |
| A0A7C1UT18 | 137-360 | None |
| A0A450SH85 | 84-351 | None |
| A0A5C5XS05 | 114-337 | None |
| A0A450UUH5 | 1-220 | None |
| A0A4Y8RV52 | 116-375 | None |
| A0A7T0BTP7 | 246-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.