DPCstruct | MC10630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 137 |
|---|---|
| Mean domain length (aa) | 83 ± 16 aa |
| Standard deviation of domain lengths | 16.44 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9FSJ8 | 8-75 | KTKIVATVGPASSSYENLLALARAGVNVFRLNFSHGSHHDHQQVIDHISYINEKYHLYLSILADLQGP |
| A0A800ECD4 | 1-83 | MGRTRVVATIGPASDSDEIIRALVDGGLDVARLNYSHGDHAGKNETYQRLRRIEAESGRPLGILADLPGPKLRLGRFEGHIDL |
| A0A2K6BUM2 | 21-103 | None |
| A0A1Q9EI60 | 848-928 | None |
| D3B0M1 | 355-463 | None |
| A0A1E7XPZ6 | 4-57 | None |
| A0A6V2BM36 | 74-150 | None |
| A0A1Q8YHR1 | 24-101 | None |
| A0A3Q0J9Y8 | 85-169 | None |
| A0A835YBR7 | 42-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.