DPCstruct | MC1063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 180 ± 13 aa |
| Standard deviation of domain lengths | 13.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060WLA0 | 1-176 | MRIEMGPSAARHGPLSALVGHLELSVQGCRAELLASTLATLGPFLEDELSADVQPMKIRLDNITITLKDDGPKIYPTAPQPQPATFT… |
| A0A402EJT6 | 170-347 | FEIGPSAAVHSPLAVRNGFLHMLIQSYHKEVLTSSLTSLGPFLEDEMIPEVIPLKIEIMDAKITLKDDSPRVYPTSPGPVPIILAAD… |
| M0R8V0 | 1257-1450 | None |
| E7FAX4 | 722-884 | None |
| A0A6A4S9E5 | 17-215 | None |
| A0A672TF16 | 80-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.