DPCstruct | MC10629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 83 ± 14 aa |
| Standard deviation of domain lengths | 13.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9KAW8 | 136-212 | SPIDLPEVVWGGMGPKDSPDLTSPLIVPATEAVYFDADDRVFGVTIEGESRAYPLRIVNAHEMVNDVVGGEPISLMW |
| A0A2T2RG64 | 133-208 | VPLDELRSGGPPPDGIPPIDDPQFESVAAADEWLTDRDPVLLIEHGNAVRAYPLAILTFHEVVNDVVAGDPLLVTY |
| A0A5N9GUL5 | 104-189 | None |
| A0A2S6U740 | 50-125 | None |
| A0A0B8PCV5 | 67-149 | None |
| A0A355B031 | 148-227 | None |
| A0A7C8D6B8 | 11-94 | None |
| A0A5N9BXI3 | 107-197 | None |
| A0A523HIR1 | 92-172 | None |
| A0A3C0TBM9 | 18-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.