DPCstruct | MC10626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 771 |
|---|---|
| Mean domain length (aa) | 227 ± 49 aa |
| Standard deviation of domain lengths | 48.72 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.31 |
| Pfam Score | 97.09 |
| Assigned Pfam label(s) | PF08381- CL0063- CL0209- CL0265- PF00795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9F290 | 38-258 | QRATLHRVLRTSIRGRGKGRHRLFSSRHLTGYIDPLKFPEAVIGWDDYRLAPLFQWFRDNPITGVVGIIERNPSGNPFIFQGIIRGG… |
| J0N9X0 | 14-216 | IMYDRQEMFDTAASIPGEETAIFAEACKKNKVWGVFSLTGEKHEQAKKNPYNTLILVNDKGEIVQKYRKILPWCPIECWYPGDKTYV… |
| A0A0F9NZQ2 | 2-169 | None |
| A0A6B0GJB7 | 37-269 | None |
| H0T619 | 21-183 | None |
| A0A6A6L6G7 | 72-279 | None |
| A0A7X1NV04 | 16-236 | None |
| A0A2Z4FGV6 | 197-448 | None |
| M9ME53 | 68-286 | None |
| A0A7C5N3B3 | 215-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.