DPCstruct | MC10625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 121 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S3U6M1 | 41-169 | MGQLREKMQTNTAQQMDLLASEDDKAEKEKIAIARYQRGCLFVVAVKDPSKFAALQENQPVRDHTTGFPLPAGTTVCDEGGNTGEII… |
| W6G166 | 2-124 | GEIQQAVRKNSTQEWKLRASQQAAQAQAEIAEQRYRDGCVMVVAMNNPDSFTSLSEGEPVIDHVRNVPLPIGTVVCDANGNTAVIIK… |
| A0A7Y3TUQ6 | 23-138 | None |
| A0A0S3U4Q9 | 30-164 | None |
| A0A1Z4LBX1 | 33-138 | None |
| A0A1U7IY90 | 31-158 | None |
| U9W2C3 | 13-141 | None |
| A0A6I5P0W9 | 30-165 | None |
| U9W1E5 | 31-130 | None |
| A0A6B3M712 | 18-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.