DPCstruct | MC10622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 2.61 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6TPL0 | 1-66 | MVAGTTSDAGKSRVTTALCRAFARRGVRVAPFKARNMANNSMACAGGAEIGHAQWVQALAAGAEPA |
| A0A3M2F1N3 | 6-75 | MVQGTSSGAGKSLLVTALCRYYARQGLRVAPFKAQNMSNNARVGVGGEMGSAQYFQALAARTTPEVRMNP |
| A0A1W1CRT3 | 33-102 | None |
| A0A2R6B1I6 | 9-71 | None |
| A0A0C2VUV2 | 1-66 | None |
| A0A4U9CZC5 | 6-70 | None |
| K1S1T1 | 1-66 | None |
| A0A7Y9RQ69 | 43-113 | None |
| A0A543I2V9 | 14-78 | None |
| A0A7H4NDB0 | 8-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.